Phylome Id: 71?q=blast
Blast Search

Enter an amino acid sequence


Example: TPDSQLIAEFVSITNSSTYLAEQYLSRNSNDLVEAVEDFYANNEPSQKSETKKSSSSNAKGSGVRTFRDLNDEDDD
EEDDKTNTNFFTGGEKSGLQVEDPNKDKDNDRSIIDQIFQKAREQMQQPDDRPSA