Phylome Id: search
Blast Search

Enter an amino acid sequence


Example: TPDSQLIAEFVSITNSSTYLAEQYLSRNSNDLVEAVEDFYANNEPSQKSETKKSSSSNAKGSGVRTFRDLNDEDDD
EEDDKTNTNFFTGGEKSGLQVEDPNKDKDNDRSIIDQIFQKAREQMQQPDDRPSA